Everything below concerns prohibited list. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2026-05-25. Where a claim depends on a specific study, the study is described rather than over-claimed.
TB-500 is a synthetic peptide preparation marketed under a name derived from thymosin beta-4, a 43-residue actin-binding protein first isolated from thymus tissue. The full-length protein has a reported molecular mass near 4963 Da, while material sold as TB-500 is often described as a fragment containing the actin-binding motif LKKTETQ. Because suppliers use the name inconsistently, published sources sometimes refer to the same label as a fragment, a synthetic copy, or a related analog. This naming ambiguity complicates direct comparison of reports across studies.
Laboratory work on thymosin beta-4 describes binding to monomeric actin and effects on cell migration, angiogenesis, and inflammatory signaling in cultured cells. Animal models have examined skin, corneal, and cardiac repair after injury, with outcomes reported mainly in preclinical literature. Most of that evidence concerns the parent protein rather than preparations labelled TB-500, so extrapolation from animal findings to a specific commercial product remains uncertain. Whether the two behave identically in living systems has not been established in controlled human studies.
TB-500 is a laboratory label applied to a short synthetic peptide that is widely described as a fragment of thymosin beta-4, an actin-binding protein present in most mammalian cells. Suppliers and review articles usually present TB-500 as the N-terminal region of that protein, but the exact sequence attached to the name is not consistent across sources. Some product descriptions list a seven-residue chain; others use the label loosely for the parent protein itself. Because of that variation, any technical discussion of TB-500 needs to state which sequence is meant.
Thymosin beta-4 contains 43 amino acids and has a reported molecular mass near 4963 Da. The short fragment most often associated with the TB-500 label, an acetylated chain beginning LKKTETQ, has a reported mass near 889 Da, so the two are easily separated in analytical work. Mass spectrometry and amino acid analysis can confirm which material is present in a given sample. Statements treating TB-500 and thymosin beta-4 as interchangeable are therefore imprecise, even though the two appear together in much of the same literature.
Interest in the compound comes largely from studies of the parent protein, which participates in actin sequestration, cell migration and tissue repair processes. Whether a short fragment reproduces those activities is a separate question that remains open in the published record. Many summaries describe mechanisms by analogy to thymosin beta-4 rather than from direct measurements on the fragment. Claims about activity should be treated as provisional unless a cited study specifies the exact peptide, its purity and the assay used.
| Property | Value | Notes |
|---|---|---|
| Molecular mass | Approximately 4963 Da for full-length thymosin beta-4 | Value applies to the parent protein; fragment products may differ |
| Appearance | White to off-white lyophilized powder | Typical form of supplied synthetic peptide |
| Solubility | Freely soluble in water | Polar peptide; dissolves readily in aqueous buffer |
| Storage of dry powder | −20 °C, desiccated, protected from light | Standard laboratory practice for peptides |
| Typical detection method | Liquid chromatography–tandem mass spectrometry | Used in purity testing and anti-doping analysis |
Peptide bonds are susceptible to hydrolysis under extreme pH and to enzymatic cleavage if proteases are present. Heat, oxidising agents, and prolonged exposure to light also contribute to loss of material. Aggregation can occur at high concentrations or in certain buffer systems, and it may not be visible to the eye. Storage at -20 C or below is typical for both powder and aliquoted solutions, and desiccation of the powder is preferred.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography together with mass spectrometry. The chromatogram provides a purity estimate as a percentage of total peak area, while the mass spectrum confirms that the observed mass matches the expected value. Amino acid analysis or tandem mass spectrometry sequencing can provide additional confirmation. Reported purity figures depend on the column, gradient, and detection wavelength, so values from different laboratories are not directly comparable without method details.
TB-500 is a catalogue name applied to a synthetic peptide related to thymosin beta-4, an actin-binding protein found in most mammalian cells. Suppliers do not use the label consistently: some describe it as the full 43-residue protein, others as a short fragment from the actin-binding region, and others as a related tetrapeptide. Because the name is commercial rather than chemical, two products sold under it may not contain the same molecule. This naming ambiguity is the first point to check in any description of the material.
The most frequently cited identity is a seven-residue fragment with the sequence LKKTETQ, taken from the actin-binding domain of the parent protein. A separate molecule, N-acetyl-seryl-aspartyl-lysyl-proline, often shortened to Ac-SDKP, derives from the same protein's N-terminal region and appears in overlapping literature. Reported molecular masses therefore differ between sources, and a mass value on its own does not establish which fragment is present. Confirmation requires a defined sequence rather than a single number.
Research interest in thymosin beta-4 fragments centres on actin sequestration, cell migration and tissue repair models. Most published work uses cultured cells or animal wound and cardiac preparations, and findings are generally described as preliminary. No fragment of this protein has been approved as a therapeutic product by major regulators. Reviews of the field note inconsistent dosing, delivery routes and outcome measures across studies, which complicates direct comparison. The material is best understood as a laboratory reagent with an active but unresolved research literature.
TB-500 is a synthetic peptide whose sequence corresponds to a short fragment near the N-terminus of thymosin beta-4, a small protein present in most mammalian cells. The fragment is commonly cited as containing the actin-binding region of the parent molecule, which is why it appears in laboratory work on cell migration and tissue repair. Suppliers distribute it as a lyophilised powder intended for research use. Its identity is defined by amino acid sequence and by the presence of an acetyl group on the N-terminal residue.
Full-length thymosin beta-4 consists of roughly forty-three amino acids and ranks among the more abundant small proteins in the cytoplasm. The fragment is much shorter, so it cannot reproduce every function attributed to the intact molecule. In cell culture, short actin-binding motifs can interfere with filament dynamics and cell movement, but such observations come from controlled experiments rather than from whole-animal work. Whether a truncated fragment produces the same effects as the parent protein remains an open question.
Interest in the peptide grew during the 2000s and 2010s, when studies of tendon and ligament injuries in horses reported changes in lesion size after treatment. Those reports circulated widely outside the scientific literature and shaped much of the current online discussion. Subsequent reviews noted inconsistent study design, small groups, and a shortage of independent replication. Popular descriptions often blur the line between the fragment, the complete protein, and unrelated growth factors, which complicates comparisons across sources.
Dry powder is commonly held at minus twenty degrees Celsius, with some suppliers recommending lower temperatures for long-term archival storage. Once dissolved, solutions are typically kept cold and protected from light, since aqueous peptide solutions can lose integrity through hydrolysis or oxidation over time. Stability data specific to this fragment are limited in the public literature, and much of the guidance comes from general peptide handling practice rather than from controlled degradation studies. Users therefore treat stated shelf lives as approximate rather than fixed.
Identity and purity are normally assessed with reversed-phase high-performance liquid chromatography, paired with mass spectrometry to confirm molecular mass. A certificate of analysis reports a purity percentage, usually derived from chromatographic peak area, but that figure does not by itself prove a correct sequence or the absence of counterions. Independent verification may include amino acid analysis or peptide mapping. Batch-to-batch variation is a documented concern in the research chemical market, and the gap between a quoted purity value and actual peptide content can be substantial when the material is a salt or retains residual water.
== Structure == In aqueous solutions, glycine exists predominantly as a zwitterion (H3N+CH2COO-), a polar molecule with both a positive and negative charge. The zwitterion form is stabilized by hydrogen bonding with solvent water molecules. Analysis of neutron diffraction data for glycine showed that it was in the zwitterionic form in the solid state and confirmed the presence of hydrogen bonds. Theoretical calculations have been used to show that zwitterions may also be present in the gas phase for some cases different from the simple carboxylic acid-to-amine transfer.
HMB is believed to reduce muscle protein breakdown in humans by inhibiting the 19S and 20S subunits of the ubiquitin–proteasome system in skeletal muscle and by inhibiting apoptosis of skeletal muscle nuclei via unidentified mechanisms. Based upon animal studies, HMB appears to be metabolized within skeletal muscle into cholesterol, which may then be incorporated into the muscle cell membrane, thereby enhancing membrane integrity and function. The effects of HMB on muscle protein metabolism may help stabilize muscle cell structure. One review suggested that the observed HMB-induced reduction in the plasma concentration of muscle damage biomarkers (i.e., muscle enzymes such as creatine kinase and lactate dehydrogenase) in humans following intense exercise may be due to a cholesterol-mediated improvement in muscle cell membrane function. HMB has been shown to stimulate the proliferation, differentiation, and fusion of human myosatellite cells in vitro, which potentially increases the regenerative capacity of skeletal muscle, by increasing the protein expression of certain myogenic regulatory factors (e.g., myoD and myogenin) and gene transcription factors (e.g., MEF2). HMB-induced human myosatellite cell proliferation in vitro is mediated through the phosphorylation of the mitogen-activated protein kinases ERK1 and ERK2. HMB-induced human myosatellite differentiation and accelerated fusion of myosatellite cells into muscle tissue in vitro is mediated through the phosphorylation of Akt, a serine/threonine-specific protein kinase.
== Business == George Batten (1854–1918), advertising executive whose firm was part of the merger that created what is now BBDO Clarence Birdseye (1886–1956), inventor, entrepreneur and naturalist who is considered to be the founder of the modern frozen food industry John C. Bogle (1929–2019), founder and CEO of The Vanguard Group, a pioneer in financial investments John J. Cali (1918–2014), real estate developer Israel Crane (1774–1858), merchant J. Clydesdale Cushman (1887–1955), businessman who co-founded the real estate firm Cushman & Wakefield in 1917 Allen B. DuMont (1901–1965), television pioneer and inventor who created the DuMont Television Network Stephen Glasser (1943–2022), American publisher who founded the Legal Times Floyd Hall (born 1935), CEO of Kmart Charles B. Johnson (born 1933), businessman Ken Kurson (born 1968), political consultant, writer and journalist, who was editor-in-chief of The New York Observer between 2013 and 2017 Geraldine Laybourne (born 1947), former TV executive and entrepreneur, co-founder of Nickelodeon and Oxygen cable networks Benjamin Moore (1905–1917), co-founder with his brother Robert of Benjamin Moore & Co, in Brooklyn in 1883; lived in Upper Montclair Guy T. Viskniskki (1876–1949), newspaper editor and news executive who founded the World War I edition of the Stars and Stripes newspaper while serving as a U.S. Army officer in France with the American Expeditionary Force Bernard Wakefield (c. 1883–1967), British-American executive who co-founded the real estate firm Cushman & Wakefield in 1917
Sources: en.wikipedia.org
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
Despite his cynical behaviour, he gradually wins over Arun's colleagues. Complications arise when Chandramouli and his brother-in-law, Lovababu, arrive unexpectedly in San Francisco. Though Uma promises to keep the story hidden and lies that he is Arun's childhood friend, Chandramouli, who has been aware of Pallavi's past involvement with someone, secretly tries to find if she is happy with Arun. During a business trip to Santa Monica, Pallavi witnesses Arun hugging another woman, leading her to suspect him of infidelity. Meanwhile, Chandramouli learns through a phone conversation with Arun's father that Arun had no childhood friend called Uma, eventually confirming Uma and Pallavi's past relationship through Pallavi's friend Kavitha. When Pallavi confronts Arun about the woman, his evasive answers increases his suspicion, prompting her to confide in Uma. Believing Pallavi will now leave Arun, Uma is approached by a remorseful Chandramouli, who offers to marry Pallavi to him. Before acting, Uma confronts Arun and discovers that the woman is Christie, a friend from Arun's MBA days in the United States. Christie had developed unrequited feelings for Arun. After he rejected her proposal, she attempted suicide and descended into drug addiction. Guilt-ridden, Arun had been secretly visiting her to support her rehabilitation. Arun reveals to Uma that he agreed to let Uma stay in their house precisely to prevent him from suffering a similar self-destructive path. Realizing Arun's integrity and selflessness, Uma decides to step aside.
== Spiking studies == In many cases, the concentration of viruses in a given sample is extremely low. In other extraction processes, low levels of impurity may be negligible, but because viruses are infective impurities, even one viral particle may be enough to ruin an entire process chain. It is for this reason that special measures must be taken to determine the appropriate removal or inactivation method for whatever type of virus is being extracted from whatever type of solution. Spiking studies were created specifically for this purpose. A spiking study is a study done in order to determine the possible methods of viral removal or inactivation. The results of these studies are numerical and, based on these numbers, researchers can determine whether or not the process on which the study was conducted will be suitable for the viruses they are trying to extract and the solution from which they are trying to extract them.
== Side effects == There had been concern that lorcaserin could cause cardiac valvulopathy based upon the reports of subjects taking the drug in Phase 2 trials. However, a 2016 Phase 3 clinical trial found no statistically significant differences in valvulopathy rates compared to control, being 2.4% for the drug subjects and 2.0% for controls, and concluded that the drug was safe for the target population although more long-term data was needed. FDA required a post-marketing cardiovascular safety trial as a condition of lorcaserin's approval (a requirement for all weight management drugs since the withdrawal of sibutramine in 2010 due to cardiovascular harm). The CAMELLIA-TIMI 61 trial was conducted for this purpose, and it showed no difference in rates of major adverse cardiovascular events ("MACE+", a composite of "cardiovascular death, myocardial infarction, stroke, hospitalization for unstable angina, heart failure, or any coronary revascularization") between lorcaserin and placebo. However secondary analysis of CAMELLIA-TIMI 61 by FDA showed a likely higher cancer risk in those taking lorcaserin. The trial was conducted in approximately 12,000 participants over five years and more patients taking lorcaserin were diagnosed with cancer compared to patients taking placebo. CAMELLIA-TIMI 61 was powered to detect differences in MACE, but was not adequately powered to detect differences in cancer rates over the five-year study period.
Sources: en.wikipedia.org
Not necessarily. TB-500 is a commercial label that suppliers apply to synthetic peptides described as thymosin beta-4 or a fragment of it. Published research most often studies the full-length protein, so statements about one do not automatically transfer to the other.
No. No major regulatory authority lists an approved product under this name, and no pharmacopoeial monograph exists for it. Material sold under the label is therefore supplied outside approved pharmaceutical channels, which affects the quality documentation available.
It falls within a prohibited class covering peptide hormones and growth factors, based on presumed effects on tissue repair and blood vessel formation. Anti-doping laboratories have published mass spectrometry methods for detecting thymosin beta-4 related peptides in urine samples.
No. TB-500 is a trade-style label used for a synthetic peptide described as a fragment of thymosin beta-4, while thymosin beta-4 is the full 43-residue protein. The two differ in size and are not interchangeable terms in analytical work.